Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNAB2 Rabbit Polyclonal Antibody (Biotin)

KCNAB2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, HKvbeta2.2

UniProt

Q6FG44

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SSVLLGASNADQLMENIGAIQVLPKLSSSIIHEIDSILGNKPYSKKDYRS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_742128

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCPS, ID (DCPS, DCS1, HINT5, m7GpppX diphosphatase, DCS-1, Hint-related 7meGMP-directed hydrolase, Histidine triad protein member 5, Scavenger mRNA-decapping enzyme DcpS) (AP)
MBS6291167-01 0.2 mL

DCPS, ID (DCPS, DCS1, HINT5, m7GpppX diphosphatase, DCS-1, Hint-related 7meGMP-directed hydrolase, Histidine triad protein member 5, Scavenger mRNA-decapping enzyme DcpS) (AP)

Sign In for Pricing
View Details
DCPS, ID (DCPS, DCS1, HINT5, m7GpppX diphosphatase, DCS-1, Hint-related 7meGMP-directed hydrolase, Histidine triad protein member 5, Scavenger mRNA-decapping enzyme DcpS) (AP)
MBS6291167-02 5x 0.2 mL

DCPS, ID (DCPS, DCS1, HINT5, m7GpppX diphosphatase, DCS-1, Hint-related 7meGMP-directed hydrolase, Histidine triad protein member 5, Scavenger mRNA-decapping enzyme DcpS) (AP)

Sign In for Pricing
View Details
Lentiviral mouse Iqsec2 shRNA (UAS) - Lentiviral mouse Iqsec2 shRNA (UAS) (25)
GTR15120125 1 Vial

Lentiviral mouse Iqsec2 shRNA (UAS) - Lentiviral mouse Iqsec2 shRNA (UAS) (25)

Sign In for Pricing
View Details
TNK2 Protein Vector (Human) (pPB-N-His)
PV043306 500 ng

TNK2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PRSS45P (NM_199183) Human Over-expression Lysate
LS377047 100 µg

PRSS45P (NM_199183) Human Over-expression Lysate

Sign In for Pricing
View Details
PRM7 Antibody
orb848768 2 mg

PRM7 Antibody

Sign In for Pricing
View Details