Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNAB2 Rabbit Polyclonal Antibody (HRP)

KCNAB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, HKvbeta2.2

UniProt

Q13303

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KCNAB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_742128

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHML Rabbit Polyclonal Antibody
orb213737-01 30 µL

CHML Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CHML Rabbit Polyclonal Antibody
orb213737-02 50 μL

CHML Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CHML Rabbit Polyclonal Antibody
orb213737-03 100 µL

CHML Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CHML Rabbit Polyclonal Antibody
orb213737-04 200 µL

CHML Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rabbit T-complex protein 1 subunit zeta (CCT6), partial
MBS1231007 Inquire

Recombinant Rabbit T-complex protein 1 subunit zeta (CCT6), partial

Sign In for Pricing
View Details
Z- (R, S) -3-amino-7-chloro-5- (2-chlorophenyl) -2-oxo-1,4-benzodiazepine
FA48310-01 500 mg

Z- (R, S) -3-amino-7-chloro-5- (2-chlorophenyl) -2-oxo-1,4-benzodiazepine

Sign In for Pricing
View Details