Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNAB2 Rabbit Polyclonal Antibody (HRP)

KCNAB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, HKvbeta2.2

UniProt

Q13303

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human KCNAB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPME

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal OSBPL11 Antibody [Alexa Fluor 594]
NBP2-36544AF594 0.1 mL

Rabbit Polyclonal OSBPL11 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Akt1 Rabbit pAb
EA243-01 50 µL

Akt1 Rabbit pAb

Sign In for Pricing
View Details
Akt1 Rabbit pAb
EA243-02 100 µL

Akt1 Rabbit pAb

Sign In for Pricing
View Details
Human papillomavirus antibody(IgM),HPV-IgM ELISA KIT
JOT-EKD0220Hu 96 wells

Human papillomavirus antibody(IgM),HPV-IgM ELISA KIT

Sign In for Pricing
View Details
CSTB (Cystatin-B, CPI-B, Stefin B, CST6, STFB, Liver Thiol Proteinase Inhibitor, Stefin-B)
125421 100 µg

CSTB (Cystatin-B, CPI-B, Stefin B, CST6, STFB, Liver Thiol Proteinase Inhibitor, Stefin-B)

Sign In for Pricing
View Details
TMEM132C (NM_001136103) Human Tagged ORF Clone Lentiviral Particle
RC226514L4V 200 µL

TMEM132C (NM_001136103) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details