Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNG1 Rabbit Polyclonal Antibody (FITC)

KCNG1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

K13, kH2, KCNG, KV6.1

UniProt

Q9UIX4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCNG1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002228

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Sulfatoxy Melatonin Sodium Salt
TRC-S689050-1MG 1 mg

6-Sulfatoxy Melatonin Sodium Salt

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (AURKB/1593), Biotin conjugate, 0.1mg/mL
BNCB1593-100 1x 100 µL

Aurora B (Proliferation Marker) (AURKB/1593), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Krt36 activation kit by CRISPRa
GA202377 1 Kit

Mouse Krt36 activation kit by CRISPRa

Sign In for Pricing
View Details
ASPA (NM_000049) Human Recombinant Protein
TP306564M 100 µg

ASPA (NM_000049) Human Recombinant Protein

Sign In for Pricing
View Details
Carboxylated - 96 well plates - 8 Well Strips on 12 x 8 frame - Clear PS
MT04F4-COOH 10x 96 Well Plates

Carboxylated - 96 well plates - 8 Well Strips on 12 x 8 frame - Clear PS

Sign In for Pricing
View Details
Recombinant Mouse Ephrin-B1/EFNB1 Protein (Fc & His Tag)
PKSM041011-01 10 µg

Recombinant Mouse Ephrin-B1/EFNB1 Protein (Fc & His Tag)

Sign In for Pricing
View Details