Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNH6 Rabbit Polyclonal Antibody (HRP)

KCNH6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ERG2, ERG-2, HERG2, Kv11.2, hERG-2

UniProt

Q9H252

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNH6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSTLYFISRGSIEILRDDVVVAILGKNDIFGEPVSLHAQPGKSSADVRAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

109kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_110406

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GroEL, Recombinant (Chaperonin 60, cpn60, Heat Shock Protein 60, HSP60)
G8976-01A1-01 20 µg

GroEL, Recombinant (Chaperonin 60, cpn60, Heat Shock Protein 60, HSP60)

Sign In for Pricing
View Details
GroEL, Recombinant (Chaperonin 60, cpn60, Heat Shock Protein 60, HSP60)
G8976-01A1-02 100 µg

GroEL, Recombinant (Chaperonin 60, cpn60, Heat Shock Protein 60, HSP60)

Sign In for Pricing
View Details
GroEL, Recombinant (Chaperonin 60, cpn60, Heat Shock Protein 60, HSP60)
G8976-01A1-03 500 µg

GroEL, Recombinant (Chaperonin 60, cpn60, Heat Shock Protein 60, HSP60)

Sign In for Pricing
View Details
GroEL, Recombinant (Chaperonin 60, cpn60, Heat Shock Protein 60, HSP60)
G8976-01A1-04 1 mg

GroEL, Recombinant (Chaperonin 60, cpn60, Heat Shock Protein 60, HSP60)

Sign In for Pricing
View Details
CTSH, NT (Cathepsin H, Cathepsin H Mini Chain, Cathepsin H Heavy Chain, Cathepsin H Light Chain, CPSB) (Biotin)
MBS6467699-01 0.2 mL

CTSH, NT (Cathepsin H, Cathepsin H Mini Chain, Cathepsin H Heavy Chain, Cathepsin H Light Chain, CPSB) (Biotin)

Sign In for Pricing
View Details
CTSH, NT (Cathepsin H, Cathepsin H Mini Chain, Cathepsin H Heavy Chain, Cathepsin H Light Chain, CPSB) (Biotin)
MBS6467699-02 5x 0.2 mL

CTSH, NT (Cathepsin H, Cathepsin H Mini Chain, Cathepsin H Heavy Chain, Cathepsin H Light Chain, CPSB) (Biotin)

Sign In for Pricing
View Details