Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNRG Rabbit Polyclonal Antibody (Biotin)

KCNRG Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DLTET

UniProt

Q0P6D0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCNRG

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQAFF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_955751

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uridine 5'-monophosphate Synthase (UMP Synthase, UMPS, OK/SW-cl.21) (FITC)
135099-FITC 100 µL

Uridine 5'-monophosphate Synthase (UMP Synthase, UMPS, OK/SW-cl.21) (FITC)

Sign In for Pricing
View Details
Rabbit anti-Mouse C-X-C motif chemokine 3 polyclonal Antibody, HRP conjugated
MBS1491017-01 0.05 mg

Rabbit anti-Mouse C-X-C motif chemokine 3 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-Mouse C-X-C motif chemokine 3 polyclonal Antibody, HRP conjugated
MBS1491017-02 0.1 mg

Rabbit anti-Mouse C-X-C motif chemokine 3 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-Mouse C-X-C motif chemokine 3 polyclonal Antibody, HRP conjugated
MBS1491017-03 5x 0.1 mg

Rabbit anti-Mouse C-X-C motif chemokine 3 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
M/M046/NT-PP-DIA100/1-B Safety & Regulatory Compliance Signs (No Adhesive)
135629 1 Pack (1 Panel (s) x 1 Pack)

M/M046/NT-PP-DIA100/1-B Safety & Regulatory Compliance Signs (No Adhesive)

Sign In for Pricing
View Details
Rabbit anti-Drosophila yakuba (Fruit fly) kay Polyclonal Antibody
MBS7170985 Inquire

Rabbit anti-Drosophila yakuba (Fruit fly) kay Polyclonal Antibody

Sign In for Pricing
View Details