Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RX2 Rabbit Polyclonal Antibody (HRP)

P2RX2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P2X2, DFNA41

UniProt

Q9UBL9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human P2RX2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IRIDVIVHGQAGKFSLIPTIINLATALTSVGVVRNPLWGPSGCGGSTRPL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_733783

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAP, InVivo Block/Neutralizing Antibody
ANT-37335-1mg 1 mg

Human FAP, InVivo Block/Neutralizing Antibody

Sign In for Pricing
View Details
TSPYL5 Rabbit Polyclonal Antibody (HRP)
orb2592368 100 µg

TSPYL5 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Guinea Pig RNA binding protein PNO1 (PNO1) ELISA kit
GTR10383491 96 Well

Guinea Pig RNA binding protein PNO1 (PNO1) ELISA kit

Sign In for Pricing
View Details
Pigeon Homeobox A10 (HOXA10) ELISA Kit
MBS9381751 Inquire

Pigeon Homeobox A10 (HOXA10) ELISA Kit

Sign In for Pricing
View Details
FKBP1B Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2503205 100 µL

FKBP1B Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Anti-DNA Polymerase epsilon 4 Antibody
MBS8292766-01 0.03 mL

Anti-DNA Polymerase epsilon 4 Antibody

Sign In for Pricing
View Details