Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RX2 Rabbit Polyclonal Antibody (FITC)

P2RX2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P2X2, DFNA41

UniProt

Q9UBL9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human P2RX2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVH

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAT13A/SRC1 Antibody
DF6263-01 100 µL

KAT13A/SRC1 Antibody

Sign In for Pricing
View Details
KAT13A/SRC1 Antibody
DF6263-02 200 µL

KAT13A/SRC1 Antibody

Sign In for Pricing
View Details
GENLISA Human Ribonuclease A10 (RNASE-10 / RNASE10) ELISA
KBH15666 1x 96 Well

GENLISA Human Ribonuclease A10 (RNASE-10 / RNASE10) ELISA

Sign In for Pricing
View Details
CYP26B1 Recombinant Protein (Human)
RP038392 100 µg

CYP26B1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Lentiviral mouse Dnajb12 shRNA (UAS) - Lentiviral mouse Dnajb12 shRNA (UAS) (100)
GTR15170922 1 Vial

Lentiviral mouse Dnajb12 shRNA (UAS) - Lentiviral mouse Dnajb12 shRNA (UAS) (100)

Sign In for Pricing
View Details
Bovine 25-hydroxy vitamin D (25 (OH) D) ELISA Kit
OM621442 96 Strip Well

Bovine 25-hydroxy vitamin D (25 (OH) D) ELISA Kit

Sign In for Pricing
View Details