Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RX2 Rabbit Polyclonal Antibody (HRP)

P2RX2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P2X2, DFNA41

UniProt

Q9UBL9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human P2RX2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVH

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Copper Metabolism Domain Containing 1
7-04852 2 µg

Recombinant Human Copper Metabolism Domain Containing 1

Sign In for Pricing
View Details
Human DELEC1 shRNA Plasmid
abx959382-01 150 µg

Human DELEC1 shRNA Plasmid

Sign In for Pricing
View Details
Human DELEC1 shRNA Plasmid
abx959382-02 300 µg

Human DELEC1 shRNA Plasmid

Sign In for Pricing
View Details
MIP-1 α) Human ELISA Kit
F0104 96 Tests

MIP-1 α) Human ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal CCT3 Antibody [Allophycocyanin]
NBP2-99266APC 0.1 mL

Rabbit Polyclonal CCT3 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
DYNC1I2 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-10471R-BF750 100 µL

DYNC1I2 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details