Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RX7 Rabbit Polyclonal Antibody (Biotin)

P2RX7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P2X7

UniProt

Q99572

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human P2RX7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTB (Actin, Cytoplasmic 1, Beta-actin) (MaxLight 750)
MBS6368668-01 0.1 mL

ACTB (Actin, Cytoplasmic 1, Beta-actin) (MaxLight 750)

Sign In for Pricing
View Details
ACTB (Actin, Cytoplasmic 1, Beta-actin) (MaxLight 750)
MBS6368668-02 5x 0.1 mL

ACTB (Actin, Cytoplasmic 1, Beta-actin) (MaxLight 750)

Sign In for Pricing
View Details
AMPK gamma, ID (5'-AMP-activated Protein Kinase Subunit gamma-1, AMPK Subunit gamma-1, AMPK gamma1, AMPKg, PRKAG1) (AP)
MBS6462799-01 0.2 mL

AMPK gamma, ID (5'-AMP-activated Protein Kinase Subunit gamma-1, AMPK Subunit gamma-1, AMPK gamma1, AMPKg, PRKAG1) (AP)

Sign In for Pricing
View Details
AMPK gamma, ID (5'-AMP-activated Protein Kinase Subunit gamma-1, AMPK Subunit gamma-1, AMPK gamma1, AMPKg, PRKAG1) (AP)
MBS6462799-02 5x 0.2 mL

AMPK gamma, ID (5'-AMP-activated Protein Kinase Subunit gamma-1, AMPK Subunit gamma-1, AMPK gamma1, AMPKg, PRKAG1) (AP)

Sign In for Pricing
View Details
Recombinant Lactobacillus plantarum Hydroxyethylthiazole kinase (thiM)
MBS1285429-01 0.02 mg (E-Coli)

Recombinant Lactobacillus plantarum Hydroxyethylthiazole kinase (thiM)

Sign In for Pricing
View Details
Recombinant Lactobacillus plantarum Hydroxyethylthiazole kinase (thiM)
MBS1285429-02 0.02 mg (Yeast)

Recombinant Lactobacillus plantarum Hydroxyethylthiazole kinase (thiM)

Sign In for Pricing
View Details