Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD4 Rabbit Polyclonal Antibody (HRP)

KCTD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BA321C24.3

UniProt

Q8WVF5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_940686

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-[ (Oct-1-yl) oxy]benzeneboronic acid
OR7245-01 1 g

4-[ (Oct-1-yl) oxy]benzeneboronic acid

Sign In for Pricing
View Details
4-[ (Oct-1-yl) oxy]benzeneboronic acid
OR7245-02 5 g

4-[ (Oct-1-yl) oxy]benzeneboronic acid

Sign In for Pricing
View Details
4-[ (Oct-1-yl) oxy]benzeneboronic acid
OR7245-03 25 g

4-[ (Oct-1-yl) oxy]benzeneboronic acid

Sign In for Pricing
View Details
TRNAD4 Adenovirus (Human)
47969051 1.0 mL

TRNAD4 Adenovirus (Human)

Sign In for Pricing
View Details
TRIP6 (Thyroid Receptor Interacting Protein 6, Thyroid Hormone Receptor Interactor 6, Thyroid Receptor-interacting Protein 6, TRI6, TRIP 6, TRIP-6, MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP 1, OIP1, OIP-1, OPA-interacting Protein 1, Zyxin-relate
MBS6397312-01 0.1 mL

TRIP6 (Thyroid Receptor Interacting Protein 6, Thyroid Hormone Receptor Interactor 6, Thyroid Receptor-interacting Protein 6, TRI6, TRIP 6, TRIP-6, MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP 1, OIP1, OIP-1, OPA-interacting Protein 1, Zyxin-relate

Sign In for Pricing
View Details
TRIP6 (Thyroid Receptor Interacting Protein 6, Thyroid Hormone Receptor Interactor 6, Thyroid Receptor-interacting Protein 6, TRI6, TRIP 6, TRIP-6, MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP 1, OIP1, OIP-1, OPA-interacting Protein 1, Zyxin-relate
MBS6397312-02 5x 0.1 mL

TRIP6 (Thyroid Receptor Interacting Protein 6, Thyroid Hormone Receptor Interactor 6, Thyroid Receptor-interacting Protein 6, TRI6, TRIP 6, TRIP-6, MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP 1, OIP1, OIP-1, OPA-interacting Protein 1, Zyxin-relate

Sign In for Pricing
View Details