Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNRG Rabbit Polyclonal Antibody (HRP)

KCNRG Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DLTET

UniProt

Q8N5I3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCNRG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VDRDGDLFSFILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNP

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775876

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL-20 Antibody (Cheng Kung U. patent anti-IL-20)
F2010-.1 100 µg

Anti-IL-20 Antibody (Cheng Kung U. patent anti-IL-20)

Sign In for Pricing
View Details
NOTCH2 Protein Vector (Human) (pPB-N-His)
PV104727 500 ng

NOTCH2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CSP Rabbit Polyclonal Antibody (HRP)
orb469808 100 µL

CSP Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Rabbit Anti-PIG54 antibody
SL6937R-01 50 µL

Rabbit Anti-PIG54 antibody

Sign In for Pricing
View Details
Rabbit Anti-PIG54 antibody
SL6937R-02 100 µL

Rabbit Anti-PIG54 antibody

Sign In for Pricing
View Details
Human GRIP and coiled-coil domain-containing protein 2 (GCC2) ELISA Kit
YLA1231HU-01 48 Tests

Human GRIP and coiled-coil domain-containing protein 2 (GCC2) ELISA Kit

Sign In for Pricing
View Details