Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cacnb2 Rabbit Polyclonal Antibody (Biotin)

Cacnb2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Cacnlb2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Cacnb2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_446303

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LSM14B cDNA Clone
MBS1267735-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

LSM14B cDNA Clone

Sign In for Pricing
View Details
LSM14B cDNA Clone
MBS1267735-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

LSM14B cDNA Clone

Sign In for Pricing
View Details
Heat Shock Factor Protein 2 (HSF2) Antibody (ALP)
abx442262 100 µg

Heat Shock Factor Protein 2 (HSF2) Antibody (ALP)

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR560703 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
CD178, NT (Apoptosis Antigen Ligand, APT1LG1, APTL, CD95 Ligand, CD95L, CD95-L, FAS Antigen Ligand, Fas Ligand, FASL, FASLG, Tumor Necrosis Factor Ligand Superfamily Member 6, TNFSF6) discontinued
C2548-91H3 50 µg

CD178, NT (Apoptosis Antigen Ligand, APT1LG1, APTL, CD95 Ligand, CD95L, CD95-L, FAS Antigen Ligand, Fas Ligand, FASL, FASLG, Tumor Necrosis Factor Ligand Superfamily Member 6, TNFSF6) discontinued

Sign In for Pricing
View Details
RFFL Protein Lysate (Mouse) with C-HA Tag
38858034 100 µg

RFFL Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details