Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cacnb2 Rabbit Polyclonal Antibody (Biotin)

Cacnb2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Cacnlb2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Cacnb2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_446303

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CDH5 Protein
E30P1321 20 µg

Recombinant Human CDH5 Protein

Sign In for Pricing
View Details
DDIT4 Polyclonal Antibody, APC-Cy7 Conjugated
bs-4240R-APC-Cy7 100 µL

DDIT4 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
RANBP3L Polyclonal Antibody, PE-Cy5 Conjugated
bs-24134R-PE-Cy5 100 µL

RANBP3L Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Marapsin (PRSS27) (NM_031948) Human Over-expression Lysate
LC403135 20 µg

Marapsin (PRSS27) (NM_031948) Human Over-expression Lysate

Sign In for Pricing
View Details
Ube2L3 Rabbit Polyclonal Antibody (PE-Cy7)
orb881389 100 µL

Ube2L3 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Interleukin 1 Beta (IL1b) Recombinant, Porcine
155313-01 10 µg

Interleukin 1 Beta (IL1b) Recombinant, Porcine

Sign In for Pricing
View Details