Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNB2 Rabbit Polyclonal Antibody (FITC)

CACNB2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CAB2, MYSB, CAVB2, CACNLB2

UniProt

Q08289

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CACNB2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: APHHNHRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASH

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

EAW86193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIGD2A, NT (HIGD2A, HIG1 domain family member 2A) (MaxLight 650) discontinued
036556-ML650 100 µL

HIGD2A, NT (HIGD2A, HIG1 domain family member 2A) (MaxLight 650) discontinued

Sign In for Pricing
View Details
SH3GL1, CT (SH3GL1, CNSA1, SH3D2B, Endophilin-A2, EEN fusion partner of MLL, Endophilin-2, Extra eleven-nineteen leukemia fusion gene protein, SH3 domain protein 2B, SH3 domain-containing GRB2-like protein 1) (MaxLight 490)
MBS6347269-01 0.1 mL

SH3GL1, CT (SH3GL1, CNSA1, SH3D2B, Endophilin-A2, EEN fusion partner of MLL, Endophilin-2, Extra eleven-nineteen leukemia fusion gene protein, SH3 domain protein 2B, SH3 domain-containing GRB2-like protein 1) (MaxLight 490)

Sign In for Pricing
View Details
SH3GL1, CT (SH3GL1, CNSA1, SH3D2B, Endophilin-A2, EEN fusion partner of MLL, Endophilin-2, Extra eleven-nineteen leukemia fusion gene protein, SH3 domain protein 2B, SH3 domain-containing GRB2-like protein 1) (MaxLight 490)
MBS6347269-02 5x 0.1 mL

SH3GL1, CT (SH3GL1, CNSA1, SH3D2B, Endophilin-A2, EEN fusion partner of MLL, Endophilin-2, Extra eleven-nineteen leukemia fusion gene protein, SH3 domain protein 2B, SH3 domain-containing GRB2-like protein 1) (MaxLight 490)

Sign In for Pricing
View Details
PI3 Rabbit Polyclonal Antibody (HRP)
orb2118182 100 µL

PI3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
(Datopotamab) Biosimilar Reference Antibody
orb3158442-01 100 µg

(Datopotamab) Biosimilar Reference Antibody

Sign In for Pricing
View Details
(Datopotamab) Biosimilar Reference Antibody
orb3158442-02 1 mg

(Datopotamab) Biosimilar Reference Antibody

Sign In for Pricing
View Details