Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-12, Canine

FGF-12 forms complexes with signaling proteins regulates the cytoskeletal system, binds to FGF receptors, activates signaling cascades to prevent apoptosis and interacts with ribosome biogenetic complexes. FGF-12 has been linked to neurological diseases, cancer and heart disease, making it a potential target and therapeutic agent for gene therapy. FGF-12 Protein, Canine is the recombinant canine-derived FGF-12 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-12 Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf12-protein-canine.html

Purity

95.40

Smiles

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Molecular Formula

478676 (Gene_ID) A0A5F4CAA4 (M1-T181) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOL3 Protein, Human, Recombinant (GST)
TMPJ-00697-01 5 µg

NOL3 Protein, Human, Recombinant (GST)

Sign In for Pricing
View Details
NOL3 Protein, Human, Recombinant (GST)
TMPJ-00697-02 10 µg

NOL3 Protein, Human, Recombinant (GST)

Sign In for Pricing
View Details
NOL3 Protein, Human, Recombinant (GST)
TMPJ-00697-03 20 µg

NOL3 Protein, Human, Recombinant (GST)

Sign In for Pricing
View Details
NOL3 Protein, Human, Recombinant (GST)
TMPJ-00697-04 50 µg

NOL3 Protein, Human, Recombinant (GST)

Sign In for Pricing
View Details
NOL3 Protein, Human, Recombinant (GST)
TMPJ-00697-05 100 µg

NOL3 Protein, Human, Recombinant (GST)

Sign In for Pricing
View Details
NOL3 Protein, Human, Recombinant (GST)
TMPJ-00697-06 200 µg

NOL3 Protein, Human, Recombinant (GST)

Sign In for Pricing
View Details