Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSBP1 Rabbit Polyclonal Antibody (FITC)

HSBP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NPC-A-13

UniProt

O75506

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HSBP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

8kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001528

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Thrombospondin-4,THBS4 ELISA KIT
JOT-EK2278Ra-01 48 Well

Rat Thrombospondin-4,THBS4 ELISA KIT

Sign In for Pricing
View Details
Rat Thrombospondin-4,THBS4 ELISA KIT
JOT-EK2278Ra-02 96 Well

Rat Thrombospondin-4,THBS4 ELISA KIT

Sign In for Pricing
View Details
PBEF (Pre-B cell Colony Enhancing Factor, Pre-B cell Enhancing Factor, Nicotinamide Phosphoribosyltransferase, NAmPRTase, NAMPT, Pre-B cell Colony Enhancing Factor 1, PBEF1, Visfatin, VF) discontinued
143694-01 50 µg

PBEF (Pre-B cell Colony Enhancing Factor, Pre-B cell Enhancing Factor, Nicotinamide Phosphoribosyltransferase, NAmPRTase, NAMPT, Pre-B cell Colony Enhancing Factor 1, PBEF1, Visfatin, VF) discontinued

Sign In for Pricing
View Details
PBEF (Pre-B cell Colony Enhancing Factor, Pre-B cell Enhancing Factor, Nicotinamide Phosphoribosyltransferase, NAmPRTase, NAMPT, Pre-B cell Colony Enhancing Factor 1, PBEF1, Visfatin, VF) discontinued
143694-02 100 µg

PBEF (Pre-B cell Colony Enhancing Factor, Pre-B cell Enhancing Factor, Nicotinamide Phosphoribosyltransferase, NAmPRTase, NAMPT, Pre-B cell Colony Enhancing Factor 1, PBEF1, Visfatin, VF) discontinued

Sign In for Pricing
View Details
ZNF530 Protein Vector (Human) (pPB-N-His)
PV047954 500 ng

ZNF530 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Human Chemokine C C motif ligand 8 ELISA Kit
MBS750141-01 48 Well

Human Chemokine C C motif ligand 8 ELISA Kit

Sign In for Pricing
View Details