Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB2 Rabbit Polyclonal Antibody (HRP)

HOXB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

K8, HOX2, HOX2H, Hox-2.8

UniProt

P14652

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RAEDGPALPPPPPPPLPAAPPAPEFPWMKEKKSAKKPSQSATSPSPAASA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002136

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT3 antibody
10R-2269 100 ul

STAT3 antibody

Sign In for Pricing
View Details
Urease (rUrease)
MBS682153 1000 Units

Urease (rUrease)

Sign In for Pricing
View Details
AP3S2 CRISPR Knock Out 293T Cell Line (Human)
12117141 1x 10^6 Cells / 1.0 mL

AP3S2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Mouse Qtrt2 Pre-designed siRNA Set A
SI111523A 1 Each

Mouse Qtrt2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
HSF4 (Heat Shock Transcription Factor 4, CTM) (MaxLight 650)
247278-ML650 100 µL

HSF4 (Heat Shock Transcription Factor 4, CTM) (MaxLight 650)

Sign In for Pricing
View Details
SH2D4A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV695263 1.0 µg DNA

SH2D4A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details