Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB2 Rabbit Polyclonal Antibody (HRP)

HOXB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

K8, HOX2, HOX2H, Hox-2.8

UniProt

P14652

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RAEDGPALPPPPPPPLPAAPPAPEFPWMKEKKSAKKPSQSATSPSPAASA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002136

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scissors Dressing 200mm Curved Sharp
INS4844 1 Each

Scissors Dressing 200mm Curved Sharp

Sign In for Pricing
View Details
IL-5 ELISA Kit (Mouse) : 96 Wells (OKAG00189)
OKAG00189 96 Well

IL-5 ELISA Kit (Mouse) : 96 Wells (OKAG00189)

Sign In for Pricing
View Details
VGF Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
49493066 1.0 µg DNA

VGF Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PIM2 Mouse Monoclonal Antibody [Clone ID: OTI8H10]
TA501070 100 µL

PIM2 Mouse Monoclonal Antibody [Clone ID: OTI8H10]

Sign In for Pricing
View Details
Human Neuropilin ELISA kit
GTR10381842 96 Well

Human Neuropilin ELISA kit

Sign In for Pricing
View Details
Human Putative zinc finger protein 735 (ZNF735) ELISA Kit
abx554964 96 Tests

Human Putative zinc finger protein 735 (ZNF735) ELISA Kit

Sign In for Pricing
View Details