Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB2 Rabbit Polyclonal Antibody (Biotin)

HOXB2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

K8, HOX2, HOX2H, Hox-2.8

UniProt

P14652

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RAEDGPALPPPPPPPLPAAPPAPEFPWMKEKKSAKKPSQSATSPSPAASA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002136

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-GFP-tag Antibody Antibody (AcalephFluor594)
orb2987067-01 30 µL

Mouse Anti-GFP-tag Antibody Antibody (AcalephFluor594)

Sign In for Pricing
View Details
Mouse Anti-GFP-tag Antibody Antibody (AcalephFluor594)
orb2987067-02 100 µL

Mouse Anti-GFP-tag Antibody Antibody (AcalephFluor594)

Sign In for Pricing
View Details
Mouse Anti-GFP-tag Antibody Antibody (AcalephFluor594)
orb2987067-03 200 µL

Mouse Anti-GFP-tag Antibody Antibody (AcalephFluor594)

Sign In for Pricing
View Details
Lentiviral mouse Zfp438 shRNA (UAS) - Lentiviral mouse Zfp438 shRNA (UAS, GFP) plasmid
GTR15257194 1 Vial

Lentiviral mouse Zfp438 shRNA (UAS) - Lentiviral mouse Zfp438 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Lentiviral human PELI3 shRNA (UAS) - Lentiviral human PELI3 shRNA (UAS, iRFP) plasmid
GTR15151660 1 Vial

Lentiviral human PELI3 shRNA (UAS) - Lentiviral human PELI3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal GBP3 Antibody
NBP1-91929-25ul 25 µL

Rabbit Polyclonal GBP3 Antibody

Sign In for Pricing
View Details