Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF35 Rabbit Polyclonal Antibody (HRP)

ZNF35 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HF10, HF.10, Zfp105

UniProt

P13682

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF35

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GQASSQQVHSENIKVWAPVQGLQTGLDGSEEEEKGQNISWDMAVVLKATQ

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

XP_005265501

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphatase, Alkaline, Liver, Bone, Kidney (Akp2, ALPI, ALPL)
P4071-18 100 µg

Phosphatase, Alkaline, Liver, Bone, Kidney (Akp2, ALPI, ALPL)

Sign In for Pricing
View Details
F2 Antibody
CSB-PA007923LA01HU-01 50 µg

F2 Antibody

Sign In for Pricing
View Details
F2 Antibody
CSB-PA007923LA01HU-02 100 µg

F2 Antibody

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Zeta (IkBz)
MBS2064285-01 0.1 mL

HRP-Linked Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Zeta (IkBz)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Zeta (IkBz)
MBS2064285-02 0.2 mL

HRP-Linked Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Zeta (IkBz)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Zeta (IkBz)
MBS2064285-03 0.5 mL

HRP-Linked Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Zeta (IkBz)

Sign In for Pricing
View Details