Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF35 Rabbit Polyclonal Antibody (Biotin)

ZNF35 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HF10, HF.10, Zfp105

UniProt

P13682

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF35

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GQASSQQVHSENIKVWAPVQGLQTGLDGSEEEEKGQNISWDMAVVLKATQ

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

XP_005265501

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS27AP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV784616 1.0 µg DNA

RPS27AP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Canine UPF0472 Protein C16orf72 (C16ORF72) ELISA Kit
MBS9930294-01 48 Well

Canine UPF0472 Protein C16orf72 (C16ORF72) ELISA Kit

Sign In for Pricing
View Details
Canine UPF0472 Protein C16orf72 (C16ORF72) ELISA Kit
MBS9930294-02 96 Well

Canine UPF0472 Protein C16orf72 (C16ORF72) ELISA Kit

Sign In for Pricing
View Details
Canine UPF0472 Protein C16orf72 (C16ORF72) ELISA Kit
MBS9930294-03 5x 96 Well

Canine UPF0472 Protein C16orf72 (C16ORF72) ELISA Kit

Sign In for Pricing
View Details
Canine UPF0472 Protein C16orf72 (C16ORF72) ELISA Kit
MBS9930294-04 10x 96 Well

Canine UPF0472 Protein C16orf72 (C16ORF72) ELISA Kit

Sign In for Pricing
View Details
Chicken ADAM metallopeptidase with ombospondin type 1 motif5 (ADAMTS5) ELISA Kit
MBS2616193-01 48 Well

Chicken ADAM metallopeptidase with ombospondin type 1 motif5 (ADAMTS5) ELISA Kit

Sign In for Pricing
View Details