Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF84 Rabbit Polyclonal Antibody (HRP)

ZNF84 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HPF2

UniProt

P51523

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF84

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RKAFSQKSQLVNHQRIHTGEKPYRCIECGKAFSQKSQLINHQRTHTVKKS

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_003419

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIB1 (mindbomb Homolog 1 (Drosophila), DIP-1, DKFZp686I0769, DKFZp761M1710, FLJ90676, MGC129659, MGC129660, MIB, ZZANK2, ZZZ6) (APC)
MBS6168339-01 0.1 mL

MIB1 (mindbomb Homolog 1 (Drosophila), DIP-1, DKFZp686I0769, DKFZp761M1710, FLJ90676, MGC129659, MGC129660, MIB, ZZANK2, ZZZ6) (APC)

Sign In for Pricing
View Details
MIB1 (mindbomb Homolog 1 (Drosophila), DIP-1, DKFZp686I0769, DKFZp761M1710, FLJ90676, MGC129659, MGC129660, MIB, ZZANK2, ZZZ6) (APC)
MBS6168339-02 5x 0.1 mL

MIB1 (mindbomb Homolog 1 (Drosophila), DIP-1, DKFZp686I0769, DKFZp761M1710, FLJ90676, MGC129659, MGC129660, MIB, ZZANK2, ZZZ6) (APC)

Sign In for Pricing
View Details
PPP1R3B, CT (PPP1R3B, PPP1R4, Protein phosphatase 1 regulatory subunit 3B, Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL, Protein phosphatase 1 regulatory subunit 4, Protein phosphatase 1 subunit GL) (MaxLight 490) discontinued
040345-ML490 100 µL

PPP1R3B, CT (PPP1R3B, PPP1R4, Protein phosphatase 1 regulatory subunit 3B, Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL, Protein phosphatase 1 regulatory subunit 4, Protein phosphatase 1 subunit GL) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Rickettsia bellii Protein TolB (tolB)
MBS1221840-01 0.02 mg (E-Coli)

Recombinant Rickettsia bellii Protein TolB (tolB)

Sign In for Pricing
View Details
Recombinant Rickettsia bellii Protein TolB (tolB)
MBS1221840-02 0.02 mg (Yeast)

Recombinant Rickettsia bellii Protein TolB (tolB)

Sign In for Pricing
View Details
Recombinant Rickettsia bellii Protein TolB (tolB)
MBS1221840-03 0.1 mg (E-Coli)

Recombinant Rickettsia bellii Protein TolB (tolB)

Sign In for Pricing
View Details