Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF124 Rabbit Polyclonal Antibody (HRP)

ZNF124 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZK7, HZF16, HZF-16

UniProt

B3KNP3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF124

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KAFSCLSSLQGHIKAHAGEEPYPCKQCGKAFRYASSLQKHEKTHIAQKPY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_003422

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HcaD Antibody
orb816576 2 mg

HcaD Antibody

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) CPR4 Polyclonal Antibody
MBS7155008 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) CPR4 Polyclonal Antibody

Sign In for Pricing
View Details
MutL Antibody
orb822068 2 mg

MutL Antibody

Sign In for Pricing
View Details
Tak1 Double Nickase Plasmid (h2)
sc-400364-NIC-2 20 µg

Tak1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Lentiviral mouse Zfy2 shRNA (UAS) - Lentiviral mouse Zfy2 shRNA (UAS, RFP) (25)
GTR15207755 1 Vial

Lentiviral mouse Zfy2 shRNA (UAS) - Lentiviral mouse Zfy2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Anti-Human CD248 Antibody (SAA0182), PE
FHJ61012 100 Tests

Anti-Human CD248 Antibody (SAA0182), PE

Sign In for Pricing
View Details