Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF133 Rabbit Polyclonal Antibody (HRP)

ZNF133 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF150, pHZ-13, pHZ-66

UniProt

Q53XU1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF133

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRGVELEASPAQTGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Porcine, Rabbit

Tested Applications

IF, WB

NCBI Accession Number

NP_003425

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF640R conjugate, 0.1mg/mL
BNC402266-500 1x 500 µL

Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
alpha 1 Antitrypsin (SERPINA1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11G2]
TA500378BM 100 µL

alpha 1 Antitrypsin (SERPINA1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11G2]

Sign In for Pricing
View Details
Bcl-x (BX006), 0.2mg/mL
BNUB0006-500 1x 500 µL

Bcl-x (BX006), 0.2mg/mL

Sign In for Pricing
View Details
TCEAL1 (NM_001006640) Human Over-expression Lysate
LY423536 100 µg

TCEAL1 (NM_001006640) Human Over-expression Lysate

Sign In for Pricing
View Details
CD137 / 4-1BB / TNFRSF9 (4-1BB/3201), CF740 conjugate, 0.1mg/mL
BNC743201-500 1x 500 µL

CD137 / 4-1BB / TNFRSF9 (4-1BB/3201), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zgpat Mouse Gene Knockout Kit (CRISPR)
KN520078 1 Kit

Zgpat Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details