Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF165 Rabbit Polyclonal Antibody (Biotin)

ZNF165 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CT53, LD65, ZSCAN7

UniProt

P49910

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF165

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: THQKSCKHGTCDQSFKWNSDFINHQIIYAGEKNHQYGKSFKSPKLAKHAA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_003438

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMT1 Rabbit pAb, BF750 conjugated
orb2892718 100 µL

DMT1 Rabbit pAb, BF750 conjugated

Sign In for Pricing
View Details
LZIC Antibody
E51A12790 100 µL

LZIC Antibody

Sign In for Pricing
View Details
APC/Cy7-Linked Polyclonal Antibody to Luteinizing Hormone Beta Polypeptide (LHb)
MBS2126301-01 0.1 mL

APC/Cy7-Linked Polyclonal Antibody to Luteinizing Hormone Beta Polypeptide (LHb)

Sign In for Pricing
View Details
APC/Cy7-Linked Polyclonal Antibody to Luteinizing Hormone Beta Polypeptide (LHb)
MBS2126301-02 0.2 mL

APC/Cy7-Linked Polyclonal Antibody to Luteinizing Hormone Beta Polypeptide (LHb)

Sign In for Pricing
View Details
APC/Cy7-Linked Polyclonal Antibody to Luteinizing Hormone Beta Polypeptide (LHb)
MBS2126301-03 0.5 mL

APC/Cy7-Linked Polyclonal Antibody to Luteinizing Hormone Beta Polypeptide (LHb)

Sign In for Pricing
View Details
APC/Cy7-Linked Polyclonal Antibody to Luteinizing Hormone Beta Polypeptide (LHb)
MBS2126301-04 1 mL

APC/Cy7-Linked Polyclonal Antibody to Luteinizing Hormone Beta Polypeptide (LHb)

Sign In for Pricing
View Details