Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX14 Rabbit Polyclonal Antibody (HRP)

SOX14 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SOX28

UniProt

O95416

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SOX14

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVG

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004180

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Succinyl CoA disodium
TYD-04294-01 10 mg

Succinyl CoA disodium

Sign In for Pricing
View Details
Succinyl CoA disodium
TYD-04294-02 50 mg

Succinyl CoA disodium

Sign In for Pricing
View Details
Matk, CT (Matk, Ctk, Ntk, Megakaryocyte-associated tyrosine-protein kinase, Protein kinase NTK, Tyrosine-protein kinase CTK) (MaxLight 650) discontinued
038221-ML650 100 µL

Matk, CT (Matk, Ctk, Ntk, Megakaryocyte-associated tyrosine-protein kinase, Protein kinase NTK, Tyrosine-protein kinase CTK) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Spleen Tyrosine Kinase (SYK) Magnetic Fluorescence Assay Kit
MBS2159745-01 96 Tests

Spleen Tyrosine Kinase (SYK) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Spleen Tyrosine Kinase (SYK) Magnetic Fluorescence Assay Kit
MBS2159745-02 5x 96 Tests

Spleen Tyrosine Kinase (SYK) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Spleen Tyrosine Kinase (SYK) Magnetic Fluorescence Assay Kit
MBS2159745-03 10x 96 Tests

Spleen Tyrosine Kinase (SYK) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details