Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX14 Rabbit Polyclonal Antibody (FITC)

SOX14 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SOX28

UniProt

O95416

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SOX14

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004180

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF92 (Zinc Finger Protein 92, Zinc Finger Protein HTF12, ZNF92) (MaxLight 650)
MBS6460658-01 0.1 mL

ZNF92 (Zinc Finger Protein 92, Zinc Finger Protein HTF12, ZNF92) (MaxLight 650)

Sign In for Pricing
View Details
ZNF92 (Zinc Finger Protein 92, Zinc Finger Protein HTF12, ZNF92) (MaxLight 650)
MBS6460658-02 5x 0.1 mL

ZNF92 (Zinc Finger Protein 92, Zinc Finger Protein HTF12, ZNF92) (MaxLight 650)

Sign In for Pricing
View Details
Human ZNF219 Protein Lysate
MBS8430192-01 0.02 mg

Human ZNF219 Protein Lysate

Sign In for Pricing
View Details
Human ZNF219 Protein Lysate
MBS8430192-02 5x 0.02 mg

Human ZNF219 Protein Lysate

Sign In for Pricing
View Details
Recombinant Escherichia coli O6 UPF0401 protein c4569 (c4569)
MBS1480755-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O6 UPF0401 protein c4569 (c4569)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6 UPF0401 protein c4569 (c4569)
MBS1480755-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O6 UPF0401 protein c4569 (c4569)

Sign In for Pricing
View Details