Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED21 Rabbit Polyclonal Antibody (Biotin)

MED21 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SRB7, SURB7, hSrb7

UniProt

Q13503

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EENHEAATCLEDVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQSLPDS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_004255

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCZD6 sgRNA CRISPR Lentivector (Human) (Target 3)
K2106704 1.0 µg DNA

SCZD6 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PE/iFluor® 647 Anti-human CD84 Antibody *CD84.1.21*
108401S0-AAT 25 Tests

PE/iFluor® 647 Anti-human CD84 Antibody *CD84.1.21*

Sign In for Pricing
View Details
Lentiviral human STX1A shRNA (UAS) - Lentiviral human STX1A shRNA (UAS, GFP) plasmid
GTR15347353 1 Vial

Lentiviral human STX1A shRNA (UAS) - Lentiviral human STX1A shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
BAD, Phosphorylated (S112) (Bad, Bbc6, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-xL/Bcl-2-associated death promoter) (MaxLight 550)
MBS6277324-01 0.1 mL

BAD, Phosphorylated (S112) (Bad, Bbc6, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-xL/Bcl-2-associated death promoter) (MaxLight 550)

Sign In for Pricing
View Details
BAD, Phosphorylated (S112) (Bad, Bbc6, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-xL/Bcl-2-associated death promoter) (MaxLight 550)
MBS6277324-02 5x 0.1 mL

BAD, Phosphorylated (S112) (Bad, Bbc6, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-xL/Bcl-2-associated death promoter) (MaxLight 550)

Sign In for Pricing
View Details
Antistreptolysin O protein
30-1045 1 mL

Antistreptolysin O protein

Sign In for Pricing
View Details