Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ILF2 Rabbit Polyclonal Antibody (Biotin)

ILF2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NF45, PRO3063

UniProt

Q12905

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ILF2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEEEE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_004506

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Protein phosphatase 1 regulatory subunit 42 (PPP1R42) ELISA Kit
abx539868 96 Tests

Human Protein phosphatase 1 regulatory subunit 42 (PPP1R42) ELISA Kit

Sign In for Pricing
View Details
LAMP1 Rabbit Polyclonal Antibody (APC)
orb994834 100 µL

LAMP1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
CD79A Rabbit Polyclonal Antibody (HRP)
orb2093984 100 µL

CD79A Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
STAT3 Rabbit mAb, 1 pack = 50 µL
BAL4515 1 Each

STAT3 Rabbit mAb, 1 pack = 50 µL

Sign In for Pricing
View Details
APOL1/Apolipoprotein L Rabbit anti-Human Polyclonal Antibody
MBS2402800-01 0.06 mL

APOL1/Apolipoprotein L Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details
APOL1/Apolipoprotein L Rabbit anti-Human Polyclonal Antibody
MBS2402800-02 5x 0.06 mL

APOL1/Apolipoprotein L Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details