Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NMI Rabbit Polyclonal Antibody (FITC)

NMI Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q13287

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NMI

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVA

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004679

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TM55B, CT (TMEM55B, C14orf9, Transmembrane protein 55B, PtdIns-4,5-P2 4-Ptase I, Type I phosphatidylinositol 4,5-bisphosphate 4-phosphatase) (MaxLight 750)
MBS6356073-01 0.1 mL

TM55B, CT (TMEM55B, C14orf9, Transmembrane protein 55B, PtdIns-4,5-P2 4-Ptase I, Type I phosphatidylinositol 4,5-bisphosphate 4-phosphatase) (MaxLight 750)

Sign In for Pricing
View Details
TM55B, CT (TMEM55B, C14orf9, Transmembrane protein 55B, PtdIns-4,5-P2 4-Ptase I, Type I phosphatidylinositol 4,5-bisphosphate 4-phosphatase) (MaxLight 750)
MBS6356073-02 5x 0.1 mL

TM55B, CT (TMEM55B, C14orf9, Transmembrane protein 55B, PtdIns-4,5-P2 4-Ptase I, Type I phosphatidylinositol 4,5-bisphosphate 4-phosphatase) (MaxLight 750)

Sign In for Pricing
View Details
Anti-Human UTP14A Polyclonal Antibody
HP931014-01 50 µg

Anti-Human UTP14A Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human UTP14A Polyclonal Antibody
HP931014-02 100 µg

Anti-Human UTP14A Polyclonal Antibody

Sign In for Pricing
View Details
IHH (Indian Hedgehog Homolog (Drosophila), BDA1, HHG2) (MaxLight 650)
247488-ML650 100 µL

IHH (Indian Hedgehog Homolog (Drosophila), BDA1, HHG2) (MaxLight 650)

Sign In for Pricing
View Details
SNX5 Rabbit Polyclonal Antibody (RBITC)
orb1057116 100 µL

SNX5 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details