Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTA1 Rabbit Polyclonal Antibody (HRP)

MTA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q13330

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MTA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QADITDLLKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGTF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL23 (IL23A) Mouse Monoclonal Antibody [Clone ID: HLT2736]
AM20386PU-N 50 µg

IL23 (IL23A) Mouse Monoclonal Antibody [Clone ID: HLT2736]

Sign In for Pricing
View Details
PTGDR Polyclonal Antibody
E-AB-65975-01 60 µL

PTGDR Polyclonal Antibody

Sign In for Pricing
View Details
PTGDR Polyclonal Antibody
E-AB-65975-02 120 µL

PTGDR Polyclonal Antibody

Sign In for Pricing
View Details
PTGDR Polyclonal Antibody
E-AB-65975-03 200 µL

PTGDR Polyclonal Antibody

Sign In for Pricing
View Details
CD8 (C8/468), CF640R conjugate, 0.1mg/mL
BNC400468-500 1x 500 µL

CD8 (C8/468), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DAB1 (NM_021080) Human Over-expression Lysate
LC402829 20 µg

DAB1 (NM_021080) Human Over-expression Lysate

Sign In for Pricing
View Details