Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLX6 Rabbit Polyclonal Antibody (FITC)

DLX6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DLX6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAAS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_376652

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse H2bc4 activation kit by CRISPRa
GA207641 1 Kit

Mouse H2bc4 activation kit by CRISPRa

Sign In for Pricing
View Details
ROR2 Mouse Monoclonal Antibody [Clone ID: OTI4B10]
CF810020 100 µg

ROR2 Mouse Monoclonal Antibody [Clone ID: OTI4B10]

Sign In for Pricing
View Details
ARRB1 Rabbit Monoclonal Antibody [Clone ID: 23GB1755]
TA424530 100 µL

ARRB1 Rabbit Monoclonal Antibody [Clone ID: 23GB1755]

Sign In for Pricing
View Details
E3 SUMO protein ligase PIAS4 (PIAS4) Rabbit Polyclonal Antibody
AP06455PU-N 100 µg

E3 SUMO protein ligase PIAS4 (PIAS4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Centaurin gamma 1 (AGAP2) (C-term) Rabbit Polyclonal Antibody
AP50861PU-N 400 µL

Centaurin gamma 1 (AGAP2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPR161 Rabbit Polyclonal Antibody
HA500098 100 µL

GPR161 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details