Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLX6 Rabbit Polyclonal Antibody (HRP)

DLX6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DLX6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAAS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_376652

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LUZP4 Mouse Monoclonal Antibody [Clone ID: OTI6D11]
CF809074 100 µg

LUZP4 Mouse Monoclonal Antibody [Clone ID: OTI6D11]

Sign In for Pricing
View Details
Mouse Antxr1 activation kit by CRISPRa
GA208217 1 Kit

Mouse Antxr1 activation kit by CRISPRa

Sign In for Pricing
View Details
N-Cbz-L-aspartic Acid
TRC-C176285-25G 25 g

N-Cbz-L-aspartic Acid

Sign In for Pricing
View Details
Napsin-A (NAPSA/1239), CF740 conjugate, 0.1mg/mL
BNC741239-500 1x 500 µL

Napsin-A (NAPSA/1239), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS506666 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
BCL10 (MALT-Lymphoma Marker) (151), CF568 conjugate, 0.1mg/mL
BNC681852-500 1x 500 µL

BCL10 (MALT-Lymphoma Marker) (151), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details