Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB3 Rabbit Polyclonal Antibody (FITC)

HMGB3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HMG4, HMG-4, HMG2A, HMG-2a

UniProt

O15347

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HMGB3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWK

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005333

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

300ul Rainin LTS tip, rack, sterile, with filter, low retention
RT300RF-L 96 PCS/Rack - 50 Racks/Case

300ul Rainin LTS tip, rack, sterile, with filter, low retention

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Coenzyme A disulfide reductase (cdr)
MBS1041323-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Coenzyme A disulfide reductase (cdr)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Coenzyme A disulfide reductase (cdr)
MBS1041323-02 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Coenzyme A disulfide reductase (cdr)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Coenzyme A disulfide reductase (cdr)
MBS1041323-03 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Coenzyme A disulfide reductase (cdr)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Coenzyme A disulfide reductase (cdr)
MBS1041323-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus Coenzyme A disulfide reductase (cdr)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Coenzyme A disulfide reductase (cdr)
MBS1041323-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus aureus Coenzyme A disulfide reductase (cdr)

Sign In for Pricing
View Details