Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB3 Rabbit Polyclonal Antibody (Biotin)

HMGB3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HMG4, HMG-4, HMG2A, HMG-2a

UniProt

O15347

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HMGB3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWK

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005333

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANGPTL3 polyclonal antibody
BS60658-01 50 µL

ANGPTL3 polyclonal antibody

Sign In for Pricing
View Details
ANGPTL3 polyclonal antibody
BS60658-02 100 µL

ANGPTL3 polyclonal antibody

Sign In for Pricing
View Details
Buffer Capsules Ph 4.2 (1 Capsule Dissolved To 100 Ml Solution)
0539B 0010C 10 Caps

Buffer Capsules Ph 4.2 (1 Capsule Dissolved To 100 Ml Solution)

Sign In for Pricing
View Details
Angiogenin, Recombinant, Human, aa25-147, His-Tag (ANG) discontinued
506161-01 10 µg

Angiogenin, Recombinant, Human, aa25-147, His-Tag (ANG) discontinued

Sign In for Pricing
View Details
Angiogenin, Recombinant, Human, aa25-147, His-Tag (ANG) discontinued
506161-02 50 µg

Angiogenin, Recombinant, Human, aa25-147, His-Tag (ANG) discontinued

Sign In for Pricing
View Details
(2- (benzyloxy) -4-fluorophenyl) (methyl) sulfane
PC1019672-01 250 mg

(2- (benzyloxy) -4-fluorophenyl) (methyl) sulfane

Sign In for Pricing
View Details