Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB3 Rabbit Polyclonal Antibody (FITC)

HMGB3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HMG4, HMG-4, HMG2A, HMG-2a

UniProt

O15347

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HMGB3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKVEE

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005333

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat DIO2 (Deiodinase, Iodothyronine, Type II) ELISA Kit
MBS8805624-01 48 Well

Rat DIO2 (Deiodinase, Iodothyronine, Type II) ELISA Kit

Sign In for Pricing
View Details
Rat DIO2 (Deiodinase, Iodothyronine, Type II) ELISA Kit
MBS8805624-02 96 Well

Rat DIO2 (Deiodinase, Iodothyronine, Type II) ELISA Kit

Sign In for Pricing
View Details
Rat DIO2 (Deiodinase, Iodothyronine, Type II) ELISA Kit
MBS8805624-03 5x 96 Well

Rat DIO2 (Deiodinase, Iodothyronine, Type II) ELISA Kit

Sign In for Pricing
View Details
Rat DIO2 (Deiodinase, Iodothyronine, Type II) ELISA Kit
MBS8805624-04 10x 96 Well

Rat DIO2 (Deiodinase, Iodothyronine, Type II) ELISA Kit

Sign In for Pricing
View Details
Anti-PON2 Rabbit Monoclonal Antibody
MA4681-.1 100 µL

Anti-PON2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Plxna2 3'UTR GFP Stable Cell Line
TU266440 1.0 mL

Plxna2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details