Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEA9 Rabbit Polyclonal Antibody (HRP)

MAGEA9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT1.9, MAGE9

UniProt

P43362

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MAGEA9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALKLKVAELVHFLLHKYRVKEPVTKAEMLESVIKNYKRYFPVIFGKASEF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_005356

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Disc Membrane Hydrophobic PVDF, 0.45μm
CPVB2545 200 PCS

Disc Membrane Hydrophobic PVDF, 0.45μm

Sign In for Pricing
View Details
ZNF426 CRISPR Activation Plasmid (m2)
sc-433416-ACT-2 20 µg

ZNF426 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Sigma factor AlgU negative regulatory protein (mucA)
orb2929566-01 20 µg

Recombinant Pseudomonas aeruginosa Sigma factor AlgU negative regulatory protein (mucA)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Sigma factor AlgU negative regulatory protein (mucA)
orb2929566-02 100 µg

Recombinant Pseudomonas aeruginosa Sigma factor AlgU negative regulatory protein (mucA)

Sign In for Pricing
View Details
PCDHAC1 Antibody - N-terminal region : FITC (ARP49341_P050-FITC)
ARP49341_P050-FITC 100 µL

PCDHAC1 Antibody - N-terminal region : FITC (ARP49341_P050-FITC)

Sign In for Pricing
View Details
MRS2L Antibody
GWB-MR547G 50 µg

MRS2L Antibody

Sign In for Pricing
View Details