Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF192 Rabbit Polyclonal Antibody (HRP)

ZNF192 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LD5-1, ZNF192, ZSCAN40

UniProt

Q15776

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF192

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAEESRKPSAPSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPLGQEVF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006289

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNIPL Mouse Monoclonal Antibody [Clone:8F6]
E45M18898 100 µg

BNIPL Mouse Monoclonal Antibody [Clone:8F6]

Sign In for Pricing
View Details
Beta Amyloid 1-28 Mouse Polyclonal Antibody (FITC)
orb466072 100 µL

Beta Amyloid 1-28 Mouse Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
T (Testosterone) Guinea Pig ELISA Kit
H4217 96 Tests

T (Testosterone) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
Rabbit forkhead box P3 (Foxp3) ELISA Kit
EIA07852Rb 1 Kit

Rabbit forkhead box P3 (Foxp3) ELISA Kit

Sign In for Pricing
View Details
FSH Receptor/FSHR Rabbit Polyclonal Antibody (PE)
orb2615851 100 µg

FSH Receptor/FSHR Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Human Golgin A5 (GOLGA5) ELISA Kit
MBS164053-01 48 Well

Human Golgin A5 (GOLGA5) ELISA Kit

Sign In for Pricing
View Details