Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMG20B Rabbit Polyclonal Antibody (FITC)

HMG20B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SOXL, HMGX2, BRAF25, BRAF35, HMGXB2, PP7706, pp8857, SMARCE1r

UniProt

Q9P0W2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HMG20B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AELRRLRKMNVAFEEQNAVLQRHTQSMSSARERLEQELALEERRTLALQQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_006330

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD14 (5A3B11B5) Alexa Fluor® 790
sc-58951 AF790 200 µg/mL

CD14 (5A3B11B5) Alexa Fluor® 790

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized protein YGL258W-A (YGL258W-A)
MBS1397863-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Uncharacterized protein YGL258W-A (YGL258W-A)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized protein YGL258W-A (YGL258W-A)
MBS1397863-02 0.1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Uncharacterized protein YGL258W-A (YGL258W-A)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized protein YGL258W-A (YGL258W-A)
MBS1397863-03 0.02 mg (Yeast)

Recombinant Saccharomyces cerevisiae Uncharacterized protein YGL258W-A (YGL258W-A)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized protein YGL258W-A (YGL258W-A)
MBS1397863-04 0.1 mg (Yeast)

Recombinant Saccharomyces cerevisiae Uncharacterized protein YGL258W-A (YGL258W-A)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized protein YGL258W-A (YGL258W-A)
MBS1397863-05 0.02 mg (Baculovirus)

Recombinant Saccharomyces cerevisiae Uncharacterized protein YGL258W-A (YGL258W-A)

Sign In for Pricing
View Details