Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF234 Rabbit Polyclonal Antibody (HRP)

ZNF234 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HZF4, ZNF269

UniProt

Q14588

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF234

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KGFKWSLNLDMHQRVHTGEKPYTCGECGKHFSQASSLQLHQSVHTGEKPY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006621

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185A-01 25 µg

Purified Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
Purified Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185A-02 100 µg

Purified Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
PDE3B (NM_000922) Human Recombinant Protein
TP319619M 100 µg

PDE3B (NM_000922) Human Recombinant Protein

Sign In for Pricing
View Details
Cdk1 / p34cdc2 Serine-Threonine Kinase (A17.1.1), CF640R conjugate, 0.1mg/mL
BNC401083-100 1x 100 µL

Cdk1 / p34cdc2 Serine-Threonine Kinase (A17.1.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tank Mouse Gene Knockout Kit (CRISPR)
KN517171 1 Kit

Tank Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytochrome P450 4A (CYP4A11) Rabbit Polyclonal Antibody
AP14735PU-N 400 µL

Cytochrome P450 4A (CYP4A11) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details