Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCML1 Rabbit Polyclonal Antibody (Biotin)

SCML1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q5H968

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SCML1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Porcine

Tested Applications

IHC, WB

NCBI Accession Number

NP_006737

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Arap1 shRNA (UAS) - Lentiviral mouse Arap1 shRNA (UAS, iRFP) (25)
GTR15253574 1 Vial

Lentiviral mouse Arap1 shRNA (UAS) - Lentiviral mouse Arap1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)
MBS2059070-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)
MBS2059070-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)
MBS2059070-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)
MBS2059070-04 1 mL

Cy3-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)
MBS2059070-05 5 mL

Cy3-Linked Polyclonal Antibody to Tumor Associated Calcium Signal Transducer 2 (TACSTD2)

Sign In for Pricing
View Details