Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RXRG Rabbit Polyclonal Antibody (HRP)

RXRG Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RXRC, NR2B3

UniProt

P48443

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RXRG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLP

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_008848

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rasl12 Antibody - N-terminal region : HRP (ARP56946_P050-HRP)
ARP56946_P050-HRP 100 µL

Rasl12 Antibody - N-terminal region : HRP (ARP56946_P050-HRP)

Sign In for Pricing
View Details
Lentiviral human TMEM69 shRNA (UAS) - Lentiviral human TMEM69 shRNA (UAS, RFP) (100)
GTR15329055 1 Vial

Lentiviral human TMEM69 shRNA (UAS) - Lentiviral human TMEM69 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
RANGE M - Red can 0.4 l
1619-R each

RANGE M - Red can 0.4 l

Sign In for Pricing
View Details
Rat Slc26a9 Pre-designed siRNA Set A
SI213069A 1 Each

Rat Slc26a9 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human HHIP (Hedgehog Interacting Protein) ELISA Kit
RE1492H-01 48 Tests

Human HHIP (Hedgehog Interacting Protein) ELISA Kit

Sign In for Pricing
View Details
Human HHIP (Hedgehog Interacting Protein) ELISA Kit
RE1492H-02 96 Tests

Human HHIP (Hedgehog Interacting Protein) ELISA Kit

Sign In for Pricing
View Details