Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF197 Rabbit Polyclonal Antibody (HRP)

ZNF197 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P18, VHLaK, ZNF20, ZNF166, ZKSCAN9, ZSCAN41, D3S1363E

UniProt

Q86VG0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF197

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTRENVAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001020026

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Automatic Polarimeter BPOL-101
BPOL-101 1 Unit

Automatic Polarimeter BPOL-101

Sign In for Pricing
View Details
Human MACC1 activation kit by CRISPRa
GA117625 1 Kit

Human MACC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human NIF1 (ZNF335) activation kit by CRISPRa
GA111919 1 Kit

Human NIF1 (ZNF335) activation kit by CRISPRa

Sign In for Pricing
View Details
ATP6V1G3 Rabbit Polyclonal Antibody
TA373847 100 µL

ATP6V1G3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FOXA1 Mouse Monoclonal Antibody [A2E8]
EM1902-34 100 µL

FOXA1 Mouse Monoclonal Antibody [A2E8]

Sign In for Pricing
View Details
Mouse Atm activation kit by CRISPRa
GA200308 1 Kit

Mouse Atm activation kit by CRISPRa

Sign In for Pricing
View Details