Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF197 Rabbit Polyclonal Antibody (Biotin)

ZNF197 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P18, VHLaK, ZNF20, ZNF166, ZKSCAN9, ZSCAN41, D3S1363E

UniProt

Q86VG0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF197

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MTRENVAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001020026

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP31 (Ubiquitin-specific-processing Protease 31, Ubiquitin Carboxyl-terminal Hydrolase 31, Deubiquitinating Enzyme 31, Ubiquitin Thioesterase 31, KIAA1203) (FITC)
135169-FITC 100 µL

USP31 (Ubiquitin-specific-processing Protease 31, Ubiquitin Carboxyl-terminal Hydrolase 31, Deubiquitinating Enzyme 31, Ubiquitin Thioesterase 31, KIAA1203) (FITC)

Sign In for Pricing
View Details
Rabbit Contactin Associated Protein 1 ELISA Kit
MBS720428-01 48 Well

Rabbit Contactin Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details
Rabbit Contactin Associated Protein 1 ELISA Kit
MBS720428-02 96 Well

Rabbit Contactin Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details
Rabbit Contactin Associated Protein 1 ELISA Kit
MBS720428-03 5x 96 Well

Rabbit Contactin Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details
Rabbit Contactin Associated Protein 1 ELISA Kit
MBS720428-04 10x 96 Well

Rabbit Contactin Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details
C9 Protein
A407 250 µL

C9 Protein

Sign In for Pricing
View Details