Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF79 Rabbit Polyclonal Antibody (Biotin)

ZNF79 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PT7

UniProt

Q15937

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF79

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LEEGVLPSPGPALPQEENTGEEGMAAGLLTAGPRGSTFFSSVTVAFAQER

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_009066

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzyl-L-norleucine methyl ester hydrochloride
265236-01 500 mg

Benzyl-L-norleucine methyl ester hydrochloride

Sign In for Pricing
View Details
Benzyl-L-norleucine methyl ester hydrochloride
265236-02 1 g

Benzyl-L-norleucine methyl ester hydrochloride

Sign In for Pricing
View Details
Benzyl-L-norleucine methyl ester hydrochloride
265236-03 2 g

Benzyl-L-norleucine methyl ester hydrochloride

Sign In for Pricing
View Details
Benzyl-L-norleucine methyl ester hydrochloride
265236-04 5 g

Benzyl-L-norleucine methyl ester hydrochloride

Sign In for Pricing
View Details
CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (MaxLight 405)
MBS6252595-01 0.1 mL

CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (MaxLight 405)

Sign In for Pricing
View Details
CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (MaxLight 405)
MBS6252595-02 5x 0.1 mL

CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (MaxLight 405)

Sign In for Pricing
View Details