Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TARDBP Rabbit Polyclonal Antibody (HRP)

TARDBP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ALS10, TDP-43

UniProt

Q13148

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TARDBP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLK

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_031401

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Egfl7 (NM_178444) Mouse Tagged ORF Clone Lentiviral Particle
MR217281L3V 200 µL

Egfl7 (NM_178444) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human GM-CSF Alexa Fluor 750 Antibody (Clone 6804)
IC615S-100UG 100 µg

Human GM-CSF Alexa Fluor 750 Antibody (Clone 6804)

Sign In for Pricing
View Details
DeBox-In (q) PCR Insert 14 x 8 low, Blue
B11253 5/Pack

DeBox-In (q) PCR Insert 14 x 8 low, Blue

Sign In for Pricing
View Details
NFKB3, ID (RELA, Transcription Factor p65, Nuclear Factor NF-kappa-B p65 Subunit, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 3) discontinued
N2302-02Z3 250 µL

NFKB3, ID (RELA, Transcription Factor p65, Nuclear Factor NF-kappa-B p65 Subunit, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 3) discontinued

Sign In for Pricing
View Details
Lentiviral human NUP54 shRNA (UAS) - Lentiviral human NUP54 shRNA (UAS) (100)
GTR15336993 1 Vial

Lentiviral human NUP54 shRNA (UAS) - Lentiviral human NUP54 shRNA (UAS) (100)

Sign In for Pricing
View Details
Recombinant human SHP-2/PTPN11 protein
ATGP3714-250 250 µg

Recombinant human SHP-2/PTPN11 protein

Sign In for Pricing
View Details