Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF3C3 Rabbit Polyclonal Antibody (FITC)

GTF3C3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TFIIIC102, TFIIICgamma, TFiiiC2-102

UniProt

Q9Y5Q9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GTF3C3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GKLSAEENPDDSEVPSSSGINSTKSQDKDVNEGETSDGVRKSVHKVFASM

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

101kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_036218

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3-Phenylpropyl)carbamic Acid Ethyl Ester
TRC-P336255-1G 1 g

(3-Phenylpropyl)carbamic Acid Ethyl Ester

Sign In for Pricing
View Details
MRPS35 (NM_021821) Human Over-expression Lysate
LY402879 100 µg

MRPS35 (NM_021821) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Heat Shock Protein 90kDa Beta 1 (HSP90b1) ELISA Kit
RD-HSP90b1-Mu-01 96 Tests

Mouse Heat Shock Protein 90kDa Beta 1 (HSP90b1) ELISA Kit

Sign In for Pricing
View Details
Mouse Heat Shock Protein 90kDa Beta 1 (HSP90b1) ELISA Kit
RD-HSP90b1-Mu-02 48 Tests

Mouse Heat Shock Protein 90kDa Beta 1 (HSP90b1) ELISA Kit

Sign In for Pricing
View Details
WAVE 1 (WASF1) (NM_001024934) Human Over-expression Lysate
LC422554 20 µg

WAVE 1 (WASF1) (NM_001024934) Human Over-expression Lysate

Sign In for Pricing
View Details
CD36 Mouse Monoclonal Antibody [Clone ID: TR9]
AM03058RP-N 100 Tests

CD36 Mouse Monoclonal Antibody [Clone ID: TR9]

Sign In for Pricing
View Details