Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF3C3 Rabbit Polyclonal Antibody (HRP)

GTF3C3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TFIIIC102, TFIIICgamma, TFiiiC2-102

UniProt

Q9Y5Q9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GTF3C3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GKLSAEENPDDSEVPSSSGINSTKSQDKDVNEGETSDGVRKSVHKVFASM

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

101kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_036218

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTLL12 Antibody
KC-28904-01 50 μL

TTLL12 Antibody

Sign In for Pricing
View Details
TTLL12 Antibody
KC-28904-02 100 µL

TTLL12 Antibody

Sign In for Pricing
View Details
TTLL12 Antibody
KC-28904-03 1 mL

TTLL12 Antibody

Sign In for Pricing
View Details
Cathepsin B (CTSB) (NM_147780) Human Over-expression Lysate
LY430182 100 µg

Cathepsin B (CTSB) (NM_147780) Human Over-expression Lysate

Sign In for Pricing
View Details
3”-O-tert-Butyl-2’-deoxymugineic Acid tert-Butyl Diethyl Ester
TRC-B809110-50MG 50 mg

3”-O-tert-Butyl-2’-deoxymugineic Acid tert-Butyl Diethyl Ester

Sign In for Pricing
View Details
Mouse Pigo activation kit by CRISPRa
GA206058 1 Kit

Mouse Pigo activation kit by CRISPRa

Sign In for Pricing
View Details