Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZP3 Rabbit Polyclonal Antibody (HRP)

ZP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZPC, ZP3A, ZP3B, Zp-3, OOMD3

UniProt

P21754

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZP3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADVTVGATDLPGQEW

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdr36 (NM_001110015) Mouse Recombinant Protein
PM44925M5 20 µg

Wdr36 (NM_001110015) Mouse Recombinant Protein

Sign In for Pricing
View Details
HP1 alpha Monoclonal Antibody, APC Conjugated
bsm-33377M-APC-01 20 µL

HP1 alpha Monoclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
HP1 alpha Monoclonal Antibody, APC Conjugated
bsm-33377M-APC-02 100 µL

HP1 alpha Monoclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Recombinant Mouse ULBP1 Protein, N-His
orb3056669-01 50 µg

Recombinant Mouse ULBP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse ULBP1 Protein, N-His
orb3056669-02 100 µg

Recombinant Mouse ULBP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse ULBP1 Protein, N-His
orb3056669-03 1 mg

Recombinant Mouse ULBP1 Protein, N-His

Sign In for Pricing
View Details